Lookerideas.net valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title LOOKER 好點子
Description N/A
Keywords N/A
Server Information
WebSite lookerideas favicon www.lookerideas.net
Host IP 104.18.61.96
Location United States
Related Websites
Site Rank
adqoo.tw #767,066
lookerideas.com #80,910
damaxww.com #3,158,829
thecatcity.com #98,711
More to Explore
adducation.info
skyscrapmetal.com.au
itau-unibanco.com
ausablevalleygrangefarmersmarkets.com
cooltech.in
themushroomcloud.co.nz
expert-saltele.ro
drimus.ro
harrisranchbeef.com
esma-3d.fr
dizinami.com
dobrolk.clan.su
Lookerideas.net Valuation
US$2,715
Last updated: Feb 16, 2020

Lookerideas.net has global traffic rank of 6,223,642. Lookerideas.net has an estimated worth of US$ 2,715, based on its estimated Ads revenue. Lookerideas.net receives approximately 495 unique visitors each day. Its web server is located in United States, with IP address 104.18.61.96. According to SiteAdvisor, lookerideas.net is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,715
Daily Ads Revenue US$1
Monthly Ads Revenue US$44
Yearly Ads Revenue US$543
Daily Unique Visitors 495
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 6,223,642
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
lookerideas.net A 299 IP: 104.18.60.96
lookerideas.net A 299 IP: 104.18.61.96
lookerideas.net AAAA 299 IPv6: 2606:4700:3033:0:0:0:6812:3d60
lookerideas.net AAAA 299 IPv6: 2606:4700:3037:0:0:0:6812:3c60
lookerideas.net NS 21599 Target: emma.ns.cloudflare.com.
lookerideas.net NS 21599 Target: duke.ns.cloudflare.com.
lookerideas.net SOA 3599 MNAME: duke.ns.cloudflare.com.
RNAME: dns.cloudflare.com.
Serial: 2033249885
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Sun, 16 Feb 2020 01:49:04 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d99bae38f36801e2e0b248ee76d7ac7671581817744; expires=Tue, 17-Mar-20 01:49:04 GMT; path=/; domain=.lookerideas.net; HttpOnly; SameSite=Lax
Location: http://www.lookerideas.net/
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 565bdce69981c5c0-EWR

HTTP/1.1 200 OK
Date: Sun, 16 Feb 2020 01:49:04 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d7b7784820e2e80a4f8da80238b26579a1581817744; expires=Tue, 17-Mar-20 01:49:04 GMT; path=/; domain=.lookerideas.net; HttpOnly; SameSite=Lax
Vary: Accept-Encoding
X-Powered-By: PHP/7.3.10
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 565bdce79c7ce6f4-EWR

Lookerideas.net Whois Information
   Domain Name: LOOKERIDEAS.NET
   Registry Domain ID: 2253281359_DOMAIN_NET-VRSN
   Registrar WHOIS Server: whois.PublicDomainRegistry.com
   Registrar URL: http://www.publicdomainregistry.com
   Updated Date: 2019-12-15T04:44:26Z
   Creation Date: 2018-04-17T02:09:28Z
   Registry Expiry Date: 2021-04-17T02:09:28Z
   Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
   Registrar IANA ID: 303
   Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
   Registrar Abuse Contact Phone: +1.2013775952
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: DUKE.NS.CLOUDFLARE.COM
   Name Server: EMMA.NS.CLOUDFLARE.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: LOOKERIDEAS.NET
Registry Domain ID: 2253281359_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2019-12-15T04:44:27Z
Creation Date: 2018-04-17T02:09:28Z
Registrar Registration Expiration Date: 2021-04-17T02:09:28Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive   
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive   
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive   
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: contact@privacyprotect.org
Name Server: duke.ns.cloudflare.com
Name Server: emma.ns.cloudflare.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

Registration Service Provided By: GOGOGO

PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to 
protect the owner from spam and phishing attacks. PrivacyProtect.org is not 
responsible for any of the activities associated with this domain name. If you wish 
to report any abuse concerning the usage of this domain name, you may do so at 
http://privacyprotect.org/contact. We have a stringent abuse policy and any 
complaint will be actioned within a short period of time.